Vosoritide Research Reference

Catalog classification, reference sizes, lab math links, and source-backed data. Educational use only — not medical advice.

Researched for: PepTools vendor-neutral scientific reference catalog

Peptide biologic; C-type natriuretic peptide analog compound Reference needs_revision Best effort · source review pending

Also known as: BMN-111, BMN 111, Voxzogo, modified recombinant human C-type natriuretic peptide, C-type natriuretic peptide analog

Open in Calculator ← Compound Index All Tools

Best-effort research profile: this record has not passed full two-source scientific verification. Descriptive fields, research protocols, storage/handling notes, and interaction guidance below are shown with their evidence labels, but calculator presets and exact dosing math remain hidden until the record is verified or reaches Community-Supported status.

Quick Facts

Reference Sizes

Not standardized / source review pending

Storage

For the approved reconstituted injectable formulation: refrigerate unopened vials and diluent at 2°C to 8°C; do not freeze; protect from light in the original package. The U.S. labeling permits specified controlled room-temperature storage for unopened product, and reconstituted solution is to be used within the labeled time period.

Best-Effort Research Profile

Vosoritide is a recombinant peptide analog of human C-type natriuretic peptide. It contains the 37 C-terminal amino acids of human CNP53 with two additional N-terminal residues, proline and glycine, intended to increase resistance to neutral endopeptidase degradation. Binding to natriuretic peptide receptor-B activates cyclic GMP signaling and antagonizes downstream FGFR3 signaling involved in endochondral bone growth.

Source review pending. This descriptive profile is shown from the available source material as a best-effort educational reference. It has not passed the full verification bar and is not a dosing instruction, medical claim, or treatment recommendation.

Research Profile

Half-Life

Mean apparent half-life approximately 21.0 to 27.9 minutes in evaluated populations; the EMA product information reports 27.9 ± 9.9 minutes in pediatric patients with achondroplasia.

Onset

Not formally established as a clinical onset parameter; median pharmacokinetic Tmax after subcutaneous administration is approximately 15 minutes.

Administration Routes (Research)

subcutaneous

Reported Research Effects

Binds and activates natriuretic peptide receptor-B (NPR-B)
Increases receptor-associated cyclic GMP signaling
Antagonizes FGFR3 downstream MAPK/ERK signaling
Promotes chondrocyte proliferation and differentiation in relevant preclinical models
Supports endochondral bone growth

Data source: Primary literature, regulator records, trial registries, and identity-specific evidence search

Reflects preclinical/research literature context only. Not a medical claim, dosing instruction, or treatment recommendation.

Research Notes

Vosoritide is an approved therapeutic peptide biologic for achondroplasia in patients with open epiphyses. The compound record describes molecular identity, pharmacology, and regulatory formulation information only; it does not provide human-use dosing or treatment instructions. Common reference sizes are not included because they are formulation- and jurisdiction-specific rather than general compound-catalog facts.

Supplementary research context only. Not medical advice or a treatment recommendation.

Registry Identifiers

Molecular formula: C176H290N56O51S3; molecular weight: approximately 4103 g/mol; PubChem CID: 119058036; CAS Registry Number: 1480724-61-5; peptide sequence: PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC, with an intramolecular disulfide bond.

Source-Backed Observations

Vosoritide is a recombinant disulfide-bonded peptide biologic. Regulatory product information describes it as a C-type natriuretic peptide analog and specifies subcutaneous administration in a reconstituted injectable formulation.

Reflects published research. Educational reference — not a recommendation for use.

Sources Under Review

Vosoritide compound record, PubChem CID 119058036
https://pubchem.ncbi.nlm.nih.gov/compound/Vosoritide (accessed 2026-08-28)

Voxzogo: EPAR Product Information
https://www.ema.europa.eu/en/documents/product-information/voxzogo-epar-product-information_en.pdf (accessed 2026-08-28)

VOXZOGO (vosoritide) U.S. Prescribing Information
https://www.accessdata.fda.gov/drugsatfda_docs/label/2024/214938s004lbl.pdf (accessed 2026-08-28)

VOXZOGO: DailyMed labeling and storage information
https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=228e8560-04a4-4bb1-a81f-29531a9e4d27 (accessed 2026-08-28)

Suggest a community source

Found a relevant Reddit or forum thread about this compound? Suggest it below. Every suggestion is reviewed by an editor before it appears -- nothing is published automatically.

Related Research Tools

Reconstitution CalculatorConcentration, draw volume, per-unit amounts Unit Convertermg, mcg, mL, units conversion Compound CompareSide-by-side comparison tool Cost CalculatorCost per mg, mcg, per-draw

Research Use Only. All content is for educational and research reference only. Not medical advice, a treatment recommendation, or guidance on human use. Compounds are not FDA-approved drugs unless specifically noted.